Antibodies Assay Kits Biology Cells cDNA Clia Kits Culture Cells Devices DNA DNA Templates Elisa Kits Enzymes Equipments Exosomes Gels Isotypes Medium & Serums NATtrol Panel Particles PCR Pcr Kits Peptides Reagents Recombinant Proteins Ria Kits RNA Test Kits Vector & Virus Western Blot

Mu-driven transposition of recombinant mini-Mu unit DNA

Mu-driven transposition of recombinant mini-Mu unit DNA within the Corynebacterium glutamicum chromosome.

A dual-component Mu-transposition system was modified for the mixing/amplification of genes in Corynebacterium. The system consists of two varieties of plasmids: (i) a non-replicative integrative plasmid that accommodates the transposing mini-Mu(LR) unit bracketed by the L/R Mu ends or the mini-Mu(LER) unit, which moreover accommodates the enhancer component, E, and (ii) an integration helper plasmid that expresses the transposition issue genes for MuA and MuB.
Environment friendly transposition within the C. glutamicum chromosome (≈ 2 × 10-Four per cell) occurred primarily by the replicative pathway by way of cointegrate formation adopted by doable decision. Optimizing the E location within the mini-Mu unit considerably elevated the effectivity of Mu-driven intramolecular transposition-amplification in C. glutamicum in addition to in gram-negative micro organism.
The brand new C. glutamicum genome modification technique that was developed permits the resultant unbiased integration/amplification/fixation of goal genes at excessive copy numbers. After integration/amplification of the primary mini-Mu(LER) unit within the C. glutamicum chromosome, the E-element, which is bracketed by lox-like websites, is excised by Cre-mediated vogue, thereby fixing the truncated mini-Mu(LR) unit in its place for the following integration/ amplification of recent mini-Mu(LER) models. This technique was demonstrated utilizing the genes for the citrine and inexperienced fluorescent proteins, yECitrine and yEGFP, respectively.

Human FLT-1/VEGFR-1 Control/blocking peptide #1

FLT11-P 100 ug
EUR 164.00

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT12-M 100 ug
EUR 482.00

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure

FLT14-M 100 ug
EUR 482.00

VEGFR-2, human recombinant protein

P1080-.1 100 µg
EUR 1929.00
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Polyclonal Goat anti-GST α-form

GST-ANTI-1 50 uL
EUR 280.00

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure

FLT15-A 100 ul
EUR 482.00

VEGFR Tyrosine Kinase Inhibitor II

C4603-1 1 mg
EUR 118.00

Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure

FLT41-A 100 ug
EUR 482.00

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1

FLT41-P 100 ug
EUR 164.00

Anti-Flt-1 antibody

STJ98080 100 µl
EUR 234.00
Description: Mouse monoclonal to Flt-1.

Anti-Flt-1 antibody

STJ93093 200 µl
EUR 197.00
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody

STJ93094 200 µl
EUR 197.00
Description: Rabbit polyclonal to Flt-1.

Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure

FLT42-A 100 ug
EUR 482.00

Anti-NPDC-1 Antibody

A12846-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Bag-1 Antibody

A02423-1 50 ul
EUR 397.00
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.

Anti-TUB 1 Antibody

A02917-1 100ug/vial
EUR 294.00

Anti-Dok-1 Antibody

A03039-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat.

Anti-TFIIIB90-1 Antibody

A03761-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse.

Anti-Atrophin-1 Antibody

A03828-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-CNG-1 Antibody

A05494-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Lyl-1 Antibody

A07491-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody

A07972-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody

A09176-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-DOC-1 Antibody

A09467-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse.

Anti-Periphilin 1 Antibody

A06996-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-PARP-1 Antibody

A00122-1 100ul
EUR 397.00
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse.

Anti-Presenilin 1 Antibody

A00138-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat.

Anti-PAI-1 Antibody

A00637-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat.

Anti-Flk-1 Antibody

A00901-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse.

Anti-EDG-1 Antibody

A01502-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody

A01530-1 100ug
EUR 455.00
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Apaf-1 (human) Monoclonal Antibody (2E12)

M00889-1 100ug
EUR 432.00
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human.

Anti-HO-1 Monoclonal Antibody (HO-1-2)

M00253-1 1mg
EUR 397.00
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat.

Human FLT-4/VEGFR-3 control/blocking peptide #2

FLT42-P 100 ug
EUR 164.00

Anti-Synaptotagmin 1/SYT1 Antibody

A02314-1 100ug/vial
EUR 334.00

Anti-Syntenin-1 Monoclonal Antibody

A02475-1 100ul
EUR 397.00
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig.

Anti-Dsg1/Desmoglein 1 Antibody

A02655-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat.

Anti-CAF-1 p150 Antibody

A02732-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse.

Anti-Talin 1/TLN1 Antibody

A02859-1 100ug/vial
EUR 334.00

Anti-Islet 1/ISL1 Antibody

A02969-1 100ug/vial
EUR 334.00

Anti-Musashi 1/Msi1 Antibody

A05052-1 100ug/vial
EUR 334.00

Anti-Pyrophosphatase 1/PPA1 Antibody

A07485-1 100ug/vial
EUR 334.00

Anti-TCP-1 eta Antibody

A08169-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat.

Anti-Relaxin 1/RLN1 Antibody

A08367-1 100ug/vial
EUR 334.00

Anti-TCP-1 zeta Antibody

A09373-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat.

Anti-CHST8/Galnac4St 1 Antibody

A10989-1 100ul
EUR 397.00
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-TNF Receptor 1 Antibody

A00294-1 200ug
EUR 522.00
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat.

Anti-Galectin 1/Lgals1 Antibody

A00470-1 100ug/vial
EUR 334.00

Anti-LOX-1/OLR1 Antibody

A00760-1 100ug/vial
EUR 294.00

Anti-Syndecan-1/SDC1 Antibody

A00991-1 100ug/vial
EUR 294.00

Anti-IRAK-1/IRAK1 Antibody

A01021-1 100ug/vial
EUR 334.00

Anti-Neurexin 1/NRXN1 Antibody

A01490-1 100ug/vial
EUR 334.00

Anti-Hexokinase 1/HK1 Antibody

A01504-1 100ug/vial
EUR 334.00

Anti-Enolase 1 Monoclonal Antibody

M01250-1 100ul
EUR 397.00
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse

Anti-Dynamin 1 Monoclonal Antibody

M02536-1 100ug
EUR 397.00
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat.

Anti-Esrp-1 Monoclonal Antibody

M06068-1 100uL
EUR 443.00
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human.

Anti-Presenilin 1 Monoclonal Antibody

M00138-1 100ug
EUR 397.00
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Galectin 1 Monoclonal Antibody

M00470-1 100ug
EUR 397.00
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DJ-1 Monoclonal Antibody

M00757-1 100ul
EUR 397.00
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human.

Anti-Angiopoietin 1/ANGPT1 Antibody

PA1333-1 100ug/vial
EUR 334.00

Anti-Galectin 1/LGALS1 Antibody

PB9240-1 100ug/vial
EUR 334.00

Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1)

M00049-1 125ug
EUR 586.00
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human.

VEGFR-1 Antibody

48347-100ul 100ul
EUR 333.00

VEGFR-1 Antibody

48347-50ul 50ul
EUR 239.00

AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif

AXMIR-1 10 reactions
EUR 438.00
  • Category: Exosome

Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378

M04431-1 100uL
EUR 385.00
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human

Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1)

M01235-1 100ug
EUR 397.00
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human.

Anti-EBP50/NHERF-1/SLC9A3R1 Antibody

A02427-1 100ug/vial
EUR 334.00

Anti-IL1R2/Il 1 Rii Antibody

A03106-1 1 ml
EUR 397.00
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human.

Anti-Hyaluronan synthase 1/HAS1 Antibody

A04784-1 100ug/vial
EUR 334.00

Anti-CELSR3/Flamingo Homolog 1 Antibody

A07204-1 100ul
EUR 397.00
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat.

Anti-LPCAT2/Acyltransferase Like 1 Antibody

A07471-1 100ul
EUR 397.00
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-HIF-1 alpha/HIF1A Antibody

A00013-1 100ug/vial
EUR 294.00

Anti-Cleaved-Notch 1 (V1754) Antibody

A00033-1 100ul
EUR 397.00
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat.

Anti-HDAC-1 (C-terminus) Antibody

A00256-1 100uL
EUR 443.00
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human.

Anti-VEGF Receptor 1/FLT1 Antibody

A00534-1 100ug/vial
EUR 294.00

Anti-Liver Carboxylesterase 1/CES1 Antibody

A01741-1 100ug/vial
EUR 334.00

Anti-Cytokeratin 1 Rabbit Monoclonal Antibody

M01639-1 100ug/vial
EUR 397.00
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Mitofusin 1 Antibody (monoclonal, 3H3)

M02172-1 100ug/vial
EUR 294.00

Anti-Sumo 1 Rabbit Monoclonal Antibody

M00631-1 100ug/vial
EUR 397.00
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Integrin alpha 1/ITGA1 Antibody

PA1045-1 100ug/vial
EUR 334.00

Anti-Caspase-1(P20)/CASP1 Antibody

PA1440-1 100ug/vial
EUR 294.00

Anti-VEGF Receptor 1/FLT1 Antibody

PA1966-1 100ug/vial
EUR 294.00

Anti-Phospho-Beclin-1 (Ser295) Antibody

P00327-1 100ul
EUR 398.00
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human.

Anti-Phospho-Raf-1 (Ser642) Antibody

P00446-1 100ul
EUR 398.00
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat.

Haptoglobin, (Phenotype 1-1) Human Plasma

EUR 321.00

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 722.00
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit

ELA-E0147r 96 Tests
EUR 886.00


DB-089-1 1 ml
EUR 750.00
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

Outcomes of cytomegalovirus DNA viral hundreds expressed in copies per millilitre and worldwide models per millilitre are equal.

Quantification of Cytomegalovirus (CMV) DNA is required for the initiation and monitoring of anti-viral remedy and the detection of viral resistance. Nonetheless, because of the lack of standardisation of CMV DNA nucleic acid checks, it’s troublesome to set common thresholds. In 2010, the 1st WHO Worldwide Normal for Human Cytomegalovirus for Nucleic Acid Amplification Strategies was launched. Since then CMV DNA viral load assays have been calibrated utilizing this normal.
Three exterior high quality evaluation (EQA) suppliers despatched the identical 5 samples to their contributors and analysed the outcomes to find out the equivalence of reporting CMV DNA leads to worldwide models per millilitre (IU/mL), and in contrast the distinction in outcomes reported in IU/mL with these reported in copies per millilitre (c/mL), and to find out the speed of adoption of IU/mL. About 78% of contributors proceed to report leads to c/mL although six of the 12 industrial assays are calibrated towards the usual.
The vary of the outcomes reported in IU/mL was lower than these reported in c/mL indicating that the adoption of the WHO normal efficiently improved the reporting of the CMV viral load.
The variation in particular person pattern outcomes reported by completely different assays, no matter whether or not in IU/mL or c/mL, continues to be nice and subsequently extra standardisation of the assays is required to permit the setting of remedy and monitoring thresholds. This research can act as a bench mark to find out price of future adoption if reporting CMV DNA viral load leads to IU/mL.

S1 satellite tv for pc DNA repetitive models show equivalent construction and total variability in all Anatolian brown frog taxa.

S1 satellite tv for pc DNA from Palearctic brown frogs has a species-specific construction in all European species. We characterised S1 satellite tv for pc DNA from the Anatolian brown frogs Rana macrocnemis, R. camerani, and R. holtzi as a way to outline their taxonomic rank and the construction of this satellite tv for pc on this frog lineage. Southern blots of genomic DNA digested with KpnI, EcoRV, NdeI, NheI, or StuI produced the identical sample of satellite tv for pc DNA bands. Furthermore, quantitative dot blots confirmed that this satellite tv for pc DNA accounts for 0.1 % of the genome in all taxa.
  • Evaluation of the general genomic variability of the S1a repeat sequence in specimens from numerous populations demonstrated that this repetitive unit additionally has the identical dimension (476 bp), the identical most typical sequence (MCS) and the identical total variability in all three taxa, and in addition in R. macrocnemis tavasensis.
  • The S1a repetitive unit presents three deletions of 9, eight and 1 bp in comparison with the 494-bp S1a repeat from European frogs. The S1a MCS has three variable positions (sequence WWTK in positions 183-186), because of the presence of two repeat subpopulations with motifs AATG and WWTT in all taxa. In contrast to beforehand analyzed mitochondrial and nuclear sequences that present appreciable variations amongst these taxa, no distinction could possibly be detected within the construction and variability of the S1 satellite tv for pc repetitive models.
  • This implies that these taxa ought to belong to a single species. Our outcomes point out that this satellite tv for pc DNA selection most likely shaped when the Anatolian lineage radiated from widespread ancestor about Four mya, and since then has maintained its construction in all 4 taxa examined.

Human DKK-1 ELISA kit

LF-EK50797 1×96T
EUR 648.00

Human CellExp? DKK-1, Human Recombinant

EUR 278.00

Human CellExp? DKK-1, Human Recombinant

EUR 1132.00

Dkk-1 Polyclonal Antibody

ABP53293-003ml 0.03ml
EUR 158.00
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-01ml 0.1ml
EUR 289.00
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-02ml 0.2ml
EUR 414.00
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

41928-100ul 100ul
EUR 252.00

Dkk-1 Polyclonal Antibody

41928-50ul 50ul
EUR 187.00

Dkk-1 Polyclonal Antibody

ES4292-100ul 100ul
EUR 279.00
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Dkk-1 Polyclonal Antibody

ES4292-50ul 50ul
EUR 207.00
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Anti-Dkk-1 antibody

STJ97257 200 µl
EUR 197.00
Description: Rabbit polyclonal to Dkk-1.

Anti-Dkk-1 antibody

STJ98000 100 µl
EUR 234.00
Description: Mouse monoclonal to Dkk-1.


GT15222 100 ug
EUR 526.00

ELISA kit for Human DKK-1

EK5390 96 tests
EUR 553.00
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1 PicoKine ELISA Kit

EK0867 96 wells
EUR 425.00
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Dkk-1 Polyclonal Conjugated Antibody

C41928 100ul
EUR 397.00

DKK-1 (CHO-expressed), Mouse

HY-P7154 50ug
EUR 762.00

Recombinant Mouse Dkk-1 Protein

RP01062 5 μg
EUR 183.00

Human DKK-1 ELISA kit (4×96T)

LF-EK50798 4×96T
EUR 2201.00

Dkk-3 antibody

22898-100ul 100ul
EUR 390.00


EF000091 96 Tests
EUR 689.00

Recombinant Human Dkk-3 Protein

RP00355 10 μg
EUR 164.00

ELISA kit for Rat DKK-1

EK5668 96 tests
EUR 553.00
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1(Dickkopf-related protein 1) ELISA Kit

EH0113 96T
EUR 524.10
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: O94907
  • Alias: DKK1/dickkopf(Xenopus laevis) homolog 1/dickkopf homolog 1(Xenopus laevis)/dickkopf related protein-1/Dickkopf-1/dickkopf-related protein 1/Dkk-1/DKK-1/SKdickkopf-1 like
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Dkk-3 Polyclonal Antibody

ABP54542-003ml 0.03ml
EUR 158.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-01ml 0.1ml
EUR 289.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-02ml 0.2ml
EUR 414.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ES5541-100ul 100ul
EUR 279.00
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody

ES5541-50ul 50ul
EUR 207.00
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Anti-Dkk-3 antibody

STJ98001 100 µl
EUR 234.00
Description: Mouse monoclonal to Dkk-3.

Anti-Dkk-3 antibody

STJ92720 200 µl
EUR 197.00
Description: Rabbit polyclonal to Dkk-3.

Human DKK-4 PicoKine ELISA Kit

EK0868 96 wells
EUR 455.00
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).

Human DKK-3 PicoKine ELISA Kit

EK1323 96 wells
EUR 425.00
Description: For quantitative detection of human DKK-3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Recombinant Human Dkk-3/DKK3 Protein

RP00209 10 μg
EUR 155.00

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-100g 100 µg
EUR 848.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-1mg 1 mg
EUR 4724.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-100g 100 µg
EUR 1013.00
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-1mg 1 mg
EUR 4999.00
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-1mg 1 mg
EUR 6374.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-250g 250 µg
EUR 2470.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-25g 25 µg
EUR 765.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-500g 500 µg
EUR 4449.00
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-50g 50 µg
EUR 1013.00
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Human DKK-3(Dickkopf-related protein 3) ELISA Kit

EH0114 96T
EUR 567.60
  • Detection range: 62.5-4000 pg/ml
  • Uniprot ID: Q9UBP4
  • Alias: DKK-3/Dickkopf-3/Dkk3/REIC
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-200g 200 µg
EUR 3844.00
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-25g 25 µg
EUR 1013.00
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Hemokinin 1 (human)

B5318-1 1 mg
EUR 340.00

Haptoglobin, (Phenotype 1-1) Human Plasma

EUR 321.00

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 722.00
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-1mg 1 mg
EUR 5494.00
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-50g 50 µg
EUR 848.00
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-200g 200 µg
EUR 1123.00
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-20g 20 µg
EUR 380.00
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

BNP (1-32), human

A1105-1 1 mg
EUR 177.00
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

IGF-1, human recombinant

P1016-.1 100 µg
EUR 763.00
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-10ug 10ug
EUR 156.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-1mg 1mg
EUR 2283.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-500ug 500ug
EUR 1613.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-50ug 50ug
EUR 369.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 3947.00
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 Regular: 10ug
EUR 317.00
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 317.00
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 317.00
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

Parathyroid hormone (1-34) (human)

A1129-1 1 mg
EUR 166.00
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276.00

ApoA-1, human recombinant protein

P1052-.1 100 µg
EUR 313.00
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein

P1052-1 1 mg
EUR 1553.00
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein

P1068-1 1 mg
EUR 6940.00
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human Gremlin-1 Protein

PROTO60565-1 50ug
EUR 317.00
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

ORM1 Orosomucoid 1 Human protein

PROTP02763-1 Regular: 10ug
EUR 317.00
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Recombinant Human ANG-1 Protein

PROTQ15389-1 20ug
EUR 317.00
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Recombinant Human Galectin-1 Protein

PROTP09382-1 50ug
EUR 317.00
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein

PROTP16284-1 50ug
EUR 317.00
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 317.00
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9

PROTP58417-1 Regular: 10ug
EUR 317.00
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1157.00
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein

PROTQ99259-1 Regular: 20ug
EUR 317.00
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)

PROTP13500-1 Regular: 20ug
EUR 317.00
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit

EP1100-1 96 Well Plate
EUR 417.00

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477.00

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit

EI2301-1 96 Well Plate
EUR 477.00

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit

EK2802-1 96 Well Plate
EUR 477.00

Ac-Endothelin-1 (16-21), human

A1016-1 1 mg
EUR 84.00
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189.00
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518.00

IFN-alpha 1, human recombinant protein

P1058-.1 100 µg
EUR 313.00
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

IFN-alpha 1, human recombinant protein

P1058-1 1 mg
EUR 2277.00
Description: IFN-?1 (also called IFN-?) is a lymphoid factor with potent antiviral antiproliferative and immunomodulatory properties. Human IFN-?1 is a 19.3 kDa protein containing 166 amino acid residues.

Recombinant Human sTRAIL Receptor-1 Protein

PROTO00220-1 50ug
EUR 317.00
Description: TRAIL Receptor-1/DR4 and TRAIL Receptor-2/DR5 belong to the TNFR superfamily of transmembrane proteins and contain a cytoplasmic "death domain, " which can activate the cell's apoptotic machinery. These receptors are activated by binding to either membrane anchored or soluble TRAIL/Apo2L. Recombinant human soluble TRAIL Receptor-1/DR4 is a 22.7 kDa protein (215 amino acid residues) consisting of the TNFR homologous, cysteine rich portion of the extracellular domain.