Antibodies Assay Kits Biology Cells cDNA Clia Kits Culture Cells Devices DNA DNA Templates Elisa Kits Enzymes Equipments Exosomes Gels Isotypes Medium & Serums NATtrol Panel Particles PCR Pcr Kits Peptides Reagents Recombinant Proteins Ria Kits RNA Test Kits Vector & Virus Western Blot

Mu-driven transposition of recombinant mini-Mu unit DNA

Mu-driven transposition of recombinant mini-Mu unit DNA within the Corynebacterium glutamicum chromosome.

A dual-component Mu-transposition system was modified for the mixing/amplification of genes in Corynebacterium. The system consists of two varieties of plasmids: (i) a non-replicative integrative plasmid that accommodates the transposing mini-Mu(LR) unit bracketed by the L/R Mu ends or the mini-Mu(LER) unit, which moreover accommodates the enhancer component, E, and (ii) an integration helper plasmid that expresses the transposition issue genes for MuA and MuB.
Environment friendly transposition within the C. glutamicum chromosome (≈ 2 × 10-Four per cell) occurred primarily by the replicative pathway by way of cointegrate formation adopted by doable decision. Optimizing the E location within the mini-Mu unit considerably elevated the effectivity of Mu-driven intramolecular transposition-amplification in C. glutamicum in addition to in gram-negative micro organism.
The brand new C. glutamicum genome modification technique that was developed permits the resultant unbiased integration/amplification/fixation of goal genes at excessive copy numbers. After integration/amplification of the primary mini-Mu(LER) unit within the C. glutamicum chromosome, the E-element, which is bracketed by lox-like websites, is excised by Cre-mediated vogue, thereby fixing the truncated mini-Mu(LR) unit in its place for the following integration/ amplification of recent mini-Mu(LER) models. This technique was demonstrated utilizing the genes for the citrine and inexperienced fluorescent proteins, yECitrine and yEGFP, respectively.
postgenomeconsortium
postgenomeconsortium

Human FLT-1/VEGFR-1 Control/blocking peptide #1
FLT11-P 100 ug
EUR 164

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure
FLT12-M 100 ug
EUR 482

Mouse Monoclonal Anti-human FLT-1/VEGFR-1 IgG, aff pure
FLT14-M 100 ug
EUR 482

VEGFR-2, human recombinant protein
P1080-.1 100 µg
EUR 1929
Description: Vascular endothelial growth factor receptor 2 (VEGFR-2) belongs to the family of receptor tyrosine kinases (RTKs) and is almost exclusively restricted to endothelial cells. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signaling activity

Rabbit Anti-Mouse FLT-1/VEGFR-1 (279-299aa) IgG, aff pure
FLT15-A 100 ul
EUR 482

Polyclonal Goat anti-GST α-form
GST-ANTI-1 50 uL
EUR 280

Rabbit Anti-Mouse FLT-4/VEGFR-3 IgG #1, aff pure
FLT41-A 100 ug
EUR 482

VEGFR Tyrosine Kinase Inhibitor II
C4603-1 1 mg
EUR 118

Mouse FLT-4/VEGFR-3 Control/blocking peptide #1
FLT41-P 100 ug
EUR 164

Anti-Flt-1 antibody
STJ93093 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody
STJ93094 200 µl
EUR 197
Description: Rabbit polyclonal to Flt-1.

Anti-Flt-1 antibody
STJ98080 100 µl
EUR 234
Description: Mouse monoclonal to Flt-1.

Anti-Periphilin 1 Antibody
A06996-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-Lyl-1 Antibody
A07491-1 100ul
EUR 397
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody
A07972-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody
A09176-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-DOC-1 Antibody
A09467-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for DOC-1 Antibody (CDK2AP1) detection. Tested with WB in Human, Mouse.

Anti-NPDC-1 Antibody
A12846-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for NPDC-1 Antibody (NPDC1) detection. Tested with WB in Human, Mouse, Rat.

Anti-CNG-1 Antibody
A05494-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CNG-1 Antibody (CNGA1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Flk-1 Antibody
A00901-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Flk-1 Antibody (KDR) detection.tested for WB in Human, Mouse.

Anti-EDG-1 Antibody
A01502-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for EDG-1 Antibody (S1PR1) detection.tested for WB in Human, Mouse, Rat.

Anti-ROBO-1 Antibody
A01530-1 100ug
EUR 455
Description: Rabbit Polyclonal ROBO-1 Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Bag-1 Antibody
A02423-1 50 ul
EUR 397
Description: Rabbit Polyclonal Bag-1 Antibody. Validated in IP, IHC and tested in Bovine, Canine, Human, Mouse, Rat.

Anti-TUB 1 Antibody
A02917-1 100ug/vial
EUR 294

Anti-Dok-1 Antibody
A03039-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dok-1 Antibody (DOK1) detection.tested for WB in Human, Mouse, Rat.

Anti-TFIIIB90-1 Antibody
A03761-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TFIIIB90-1 Antibody (BRF1) detection.tested for WB in Human, Mouse.

Anti-Atrophin-1 Antibody
A03828-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Atrophin-1 Antibody (ATN1) detection. Tested with WB in Human, Mouse, Rat.

Anti-PARP-1 Antibody
A00122-1 100ul
EUR 397
Description: Rabbit Polyclonal PARP-1 Antibody. Validated in ELISA, IP, IF, WB and tested in Human, Mouse.

Anti-Presenilin 1 Antibody
A00138-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Presenilin 1 Antibody (PSEN1) detection. Tested with WB, IHC in Human, Mouse, Rat.

Anti-PAI-1 Antibody
A00637-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for PAI-1 Antibody (SERPINE1) detection.tested for WB in Human, Mouse, Rat.

Rabbit Anti-Human FLT-4/VEGFR-3 IgG #2, aff pure
FLT42-A 100 ug
EUR 482

Anti-Apaf-1 (human) Monoclonal Antibody (2E12)
M00889-1 100ug
EUR 432
Description: Rat Monoclonal Apaf-1 (human) Antibody (2E12). Validated in ELISA, IP, IF, WB and tested in Human.

Anti-HO-1 Monoclonal Antibody (HO-1-2)
M00253-1 1mg
EUR 397
Description: Mouse Monoclonal HO-1 Antibody (HO-1-2). Validated in Flow Cytometry, IHC, WB and tested in Human, Mouse, Rat.

Anti-Pyrophosphatase 1/PPA1 Antibody
A07485-1 100ug/vial
EUR 334

Anti-TCP-1 eta Antibody
A08169-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 eta Antibody (CCT7) detection. Tested with WB in Human, Mouse, Rat.

Anti-Relaxin 1/RLN1 Antibody
A08367-1 100ug/vial
EUR 334

Anti-TCP-1 zeta Antibody
A09373-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for TCP-1 zeta Antibody (CCT6A) detection.tested for WB in Human, Mouse, Rat.

Anti-CHST8/Galnac4St 1 Antibody
A10989-1 100ul
EUR 397
Description: Rabbit Polyclonal CHST8/Galnac4St 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Musashi 1/Msi1 Antibody
A05052-1 100ug/vial
EUR 334

Anti-LOX-1/OLR1 Antibody
A00760-1 100ug/vial
EUR 294

Anti-Syndecan-1/SDC1 Antibody
A00991-1 100ug/vial
EUR 294

Anti-IRAK-1/IRAK1 Antibody
A01021-1 100ug/vial
EUR 334

Anti-Neurexin 1/NRXN1 Antibody
A01490-1 100ug/vial
EUR 334

Anti-Hexokinase 1/HK1 Antibody
A01504-1 100ug/vial
EUR 334

Anti-Synaptotagmin 1/SYT1 Antibody
A02314-1 100ug/vial
EUR 334

Anti-Syntenin-1 Monoclonal Antibody
A02475-1 100ul
EUR 397
Description: Mouse Monoclonal Antibody for Syntenin-1 Antibody (SDCBP) detection. Tested with WB in Human, Rat, Dog, Pig.

Anti-Dsg1/Desmoglein 1 Antibody
A02655-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Dsg1 Antibody (DSG1) detection.tested for IHC, WB in Human, Mouse, Rat.

Anti-CAF-1 p150 Antibody
A02732-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for CAF-1 p150 Antibody (CHAF1A) detection. Tested with WB in Human, Mouse.

Anti-Talin 1/TLN1 Antibody
A02859-1 100ug/vial
EUR 334

Anti-Islet 1/ISL1 Antibody
A02969-1 100ug/vial
EUR 334

Anti-TNF Receptor 1 Antibody
A00294-1 200ug
EUR 522
Description: Rabbit Polyclonal TNF Receptor 1 Antibody. Validated in IP, IHC, WB and tested in Human, Mouse, Rat.

Anti-Galectin 1/Lgals1 Antibody
A00470-1 100ug/vial
EUR 334

Anti-Angiopoietin 1/ANGPT1 Antibody
PA1333-1 100ug/vial
EUR 334

Anti-Presenilin 1 Monoclonal Antibody
M00138-1 100ug
EUR 397
Description: Rabbit Monoclonal Presenilin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Galectin 1 Monoclonal Antibody
M00470-1 100ug
EUR 397
Description: Rabbit Monoclonal Galectin 1 Antibody. Validated in IP, IF, WB and tested in Human, Mouse, Rat.

Anti-DJ-1 Monoclonal Antibody
M00757-1 100ul
EUR 397
Description: Mouse Monoclonal DJ-1 Antibody. Validated in IHC, WB and tested in Bovine, Human.

Anti-Enolase 1 Monoclonal Antibody
M01250-1 100ul
EUR 397
Description: Anti-Enolase 1 Monoclonal Antibody tested in WB, IF, ICC, IHC, reactive to Human, rat, mouse, cow, pig, horse

Anti-Dynamin 1 Monoclonal Antibody
M02536-1 100ug
EUR 397
Description: Rabbit Monoclonal Dynamin 1 Antibody. Validated in IF, WB and tested in Human, Mouse, Rat.

Anti-Esrp-1 Monoclonal Antibody
M06068-1 100uL
EUR 443
Description: Mouse Monoclonal Esrp-1 Antibody. Validated in WB and tested in Human.

Anti-Galectin 1/LGALS1 Antibody
PB9240-1 100ug/vial
EUR 334

VEGFR-1 Antibody
48347-100ul 100ul
EUR 333

VEGFR-1 Antibody
48347-50ul 50ul
EUR 239

Anti-P-glycoprotein (human) Monoclonal Antibody (JSB-1)
M00049-1 125ug
EUR 586
Description: Mouse Monoclonal P-glycoprotein (human) Antibody (JSB-1). Validated in IF and tested in Human.

Human FLT-4/VEGFR-3 control/blocking peptide #2
FLT42-P 100 ug
EUR 164

AXMIR-1 RNA oligo anti-miRNA-1-3p with Xmotif
AXMIR-1 10 reactions
EUR 438
  • Category: Exosome

Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378
M04431-1 100uL
EUR 385
Description: Anti-BOB-1/OBF-1 Rabbit Monoclonal Antibody, Clone#RM378 tested in WB, IHC, reactive to Human

Anti-CELSR3/Flamingo Homolog 1 Antibody
A07204-1 100ul
EUR 397
Description: Rabbit Polyclonal CELSR3/Flamingo Homolog 1 Antibody. Validated in IF and tested in Human, Mouse, Rat.

Anti-LPCAT2/Acyltransferase Like 1 Antibody
A07471-1 100ul
EUR 397
Description: Rabbit Polyclonal LPCAT2/Acyltransferase Like 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Hyaluronan synthase 1/HAS1 Antibody
A04784-1 100ug/vial
EUR 334

Anti-Liver Carboxylesterase 1/CES1 Antibody
A01741-1 100ug/vial
EUR 334

Anti-EBP50/NHERF-1/SLC9A3R1 Antibody
A02427-1 100ug/vial
EUR 334

Anti-IL1R2/Il 1 Rii Antibody
A03106-1 1 ml
EUR 397
Description: Rabbit Polyclonal IL1R2/Il 1 Rii Antibody. Validated in IP, WB and tested in Human.

Anti-HIF-1 alpha/HIF1A Antibody
A00013-1 100ug/vial
EUR 294

Anti-Cleaved-Notch 1 (V1754) Antibody
A00033-1 100ul
EUR 397
Description: Rabbit Polyclonal Antibody for Cleaved-Notch 1 (V1754) Antibody (NOTCH1) detection.tested for WB in Human, Mouse, Rat.

Anti-HDAC-1 (C-terminus) Antibody
A00256-1 100uL
EUR 443
Description: Rabbit Polyclonal HDAC-1 (C-terminus) Antibody. Validated in IF, IHC, WB and tested in Human.

Anti-VEGF Receptor 1/FLT1 Antibody
A00534-1 100ug/vial
EUR 294

Anti-Integrin alpha 1/ITGA1 Antibody
PA1045-1 100ug/vial
EUR 334

Anti-Caspase-1(P20)/CASP1 Antibody
PA1440-1 100ug/vial
EUR 294

Anti-VEGF Receptor 1/FLT1 Antibody
PA1966-1 100ug/vial
EUR 294

Anti-Sumo 1 Rabbit Monoclonal Antibody
M00631-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Sumo 1 Antibody. Validated in IP, IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-Cytokeratin 1 Rabbit Monoclonal Antibody
M01639-1 100ug/vial
EUR 397
Description: Rabbit Monoclonal Cytokeratin 1 Antibody. Validated in WB and tested in Human, Mouse, Rat.

Anti-Mitofusin 1 Antibody (monoclonal, 3H3)
M02172-1 100ug/vial
EUR 294

Anti-Phospho-Beclin-1 (Ser295) Antibody
P00327-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Beclin-1 (Ser295) Antibody. Validated in WB and tested in Human.

Anti-Phospho-Raf-1 (Ser642) Antibody
P00446-1 100ul
EUR 398
Description: Rabbit Polyclonal Phospho-Raf-1 (Ser642) Antibody. Validated in WB and tested in Human, Rat.

Anti-HLA-G (human) Monoclonal Antibody (MEM-G/1)
M01235-1 100ug
EUR 397
Description: Mouse Monoclonal HLA-G (human) Antibody (MEM-G/1). Validated in IHC, WB and tested in Human.

Anti-TTF-1
DB-089-1 1 ml
EUR 750
Description: rabbit monospecific clonal antibodies for ihc-p application; concentrated

VEGFR-1/Flt1/ Rat VEGFR- 1/ Flt1 ELISA Kit
ELA-E0147r 96 Tests
EUR 886

Anti-Phospho-Flt-1 (Y1333) antibody
STJ90838 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1333).

Anti-Phospho-Flt-1 (Y1048) antibody
STJ91223 200 µl
EUR 197
Description: Rabbit polyclonal to Phospho-Flt-1 (Y1048).

Outcomes of cytomegalovirus DNA viral hundreds expressed in copies per millilitre and worldwide models per millilitre are equal.

Quantification of Cytomegalovirus (CMV) DNA is required for the initiation and monitoring of anti-viral remedy and the detection of viral resistance. Nonetheless, because of the lack of standardisation of CMV DNA nucleic acid checks, it’s troublesome to set common thresholds. In 2010, the 1st WHO Worldwide Normal for Human Cytomegalovirus for Nucleic Acid Amplification Strategies was launched. Since then CMV DNA viral load assays have been calibrated utilizing this normal.
Three exterior high quality evaluation (EQA) suppliers despatched the identical 5 samples to their contributors and analysed the outcomes to find out the equivalence of reporting CMV DNA leads to worldwide models per millilitre (IU/mL), and in contrast the distinction in outcomes reported in IU/mL with these reported in copies per millilitre (c/mL), and to find out the speed of adoption of IU/mL. About 78% of contributors proceed to report leads to c/mL although six of the 12 industrial assays are calibrated towards the usual.
The vary of the outcomes reported in IU/mL was lower than these reported in c/mL indicating that the adoption of the WHO normal efficiently improved the reporting of the CMV viral load.
The variation in particular person pattern outcomes reported by completely different assays, no matter whether or not in IU/mL or c/mL, continues to be nice and subsequently extra standardisation of the assays is required to permit the setting of remedy and monitoring thresholds. This research can act as a bench mark to find out price of future adoption if reporting CMV DNA viral load leads to IU/mL.

S1 satellite tv for pc DNA repetitive models show equivalent construction and total variability in all Anatolian brown frog taxa.

S1 satellite tv for pc DNA from Palearctic brown frogs has a species-specific construction in all European species. We characterised S1 satellite tv for pc DNA from the Anatolian brown frogs Rana macrocnemis, R. camerani, and R. holtzi as a way to outline their taxonomic rank and the construction of this satellite tv for pc on this frog lineage. Southern blots of genomic DNA digested with KpnI, EcoRV, NdeI, NheI, or StuI produced the identical sample of satellite tv for pc DNA bands. Furthermore, quantitative dot blots confirmed that this satellite tv for pc DNA accounts for 0.1 % of the genome in all taxa.
  • Evaluation of the general genomic variability of the S1a repeat sequence in specimens from numerous populations demonstrated that this repetitive unit additionally has the identical dimension (476 bp), the identical most typical sequence (MCS) and the identical total variability in all three taxa, and in addition in R. macrocnemis tavasensis.
  • The S1a repetitive unit presents three deletions of 9, eight and 1 bp in comparison with the 494-bp S1a repeat from European frogs. The S1a MCS has three variable positions (sequence WWTK in positions 183-186), because of the presence of two repeat subpopulations with motifs AATG and WWTT in all taxa. In contrast to beforehand analyzed mitochondrial and nuclear sequences that present appreciable variations amongst these taxa, no distinction could possibly be detected within the construction and variability of the S1 satellite tv for pc repetitive models.
  • This implies that these taxa ought to belong to a single species. Our outcomes point out that this satellite tv for pc DNA selection most likely shaped when the Anatolian lineage radiated from widespread ancestor about Four mya, and since then has maintained its construction in all 4 taxa examined.

Recombinant Human DKK-1 Protein
PROTO94907-3 10ug
EUR 317
Description: DKK-1 is a member of the DKK protein family which also includes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. Subsequent studies have shown that DKK-1 and DKK-4 play an important regulatory role in the Wnt /β-catenin signaling pathway by forming inhibitory complexes with LDL receptor-related proteins 5 and 6 (LRP5 and LRP6), which are essential components of the Wnt/βcatenin signaling system. LPR5 and LPR6 are single-pass transmembrane proteins that appear to act as co-receptors for Wnt ligands involved in the Wnt/βcatenin signaling cascade. It has been suggested that by inhibiting Wnt/β-catenin signaling, which is essential for posterior patterning in vertebrates, DKK-1 permits anterior development. This notion is supported by the finding that mice deficient of DKK-1 expression lack head formation and die during embryogenesis. Recombinant human DKK-1 expressed in human 293 cells is a 35-40 kDa glycoprotein containing 235 amino-acid residues.

Dkk-1 Polyclonal Antibody
41928-100ul 100ul
EUR 252

Dkk-1 Polyclonal Antibody
41928-50ul 50ul
EUR 187

Dkk-1 Polyclonal Antibody
ABP53293-003ml 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody
ABP53293-01ml 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody
ABP53293-02ml 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody
ES4292-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Dkk-1 Polyclonal Antibody
ES4292-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Anti-Dkk-1 antibody
STJ97257 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-1.

Anti-Dkk-1 antibody
STJ98000 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-1.

Human CellExp? DKK-1, Human Recombinant
7132-10
EUR 278

Human CellExp? DKK-1, Human Recombinant
7132-50
EUR 1132

Dkk-2
GT15222 100 ug
EUR 526

ELISA kit for Human DKK-1
EK5390 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1 PicoKine ELISA Kit
EK0867 96 wells
EUR 425
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Dkk-1 Polyclonal Conjugated Antibody
C41928 100ul
EUR 397

DKK-1 (CHO-expressed), Mouse
HY-P7154 50ug
EUR 762

Recombinant Mouse Dkk-1 Protein
RP01062 5 μg
EUR 183

Human DKK-1 ELISA kit (4×96T)
LF-EK50798 4×96T
EUR 2201

Dkk-3 antibody
22898-100ul 100ul
EUR 390

DKK-3 ELISA KIT|Human
EF000091 96 Tests
EUR 689

Recombinant Human Dkk-3 Protein
RP00355 10 μg
EUR 164

ELISA kit for Rat DKK-1
EK5668 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1(Dickkopf-related protein 1) ELISA Kit
EH0113 96T
EUR 524.1
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: O94907
  • Alias: DKK1/dickkopf(Xenopus laevis) homolog 1/dickkopf homolog 1(Xenopus laevis)/dickkopf related protein-1/Dickkopf-1/dickkopf-related protein 1/Dkk-1/DKK-1/SKdickkopf-1 like
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Dkk-1 ELISA Kit (Human) : 96 Wells (OKAG00221)
OKAG00221 96 Wells
EUR 596
Description: Description of target: This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.;Species reactivity: Human;Application: ELISA;Assay info: Quantitative Colorimentric Sandwich ELISA;Sensitivity: 63 pg/mL

Dkk-3 Polyclonal Antibody
ABP54542-003ml 0.03ml
EUR 158
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody
ABP54542-01ml 0.1ml
EUR 289
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody
ABP54542-02ml 0.2ml
EUR 414
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody
ES5541-100ul 100ul
EUR 279
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody
ES5541-50ul 50ul
EUR 207
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Anti-Dkk-3 antibody
STJ92720 200 µl
EUR 197
Description: Rabbit polyclonal to Dkk-3.

Anti-Dkk-3 antibody
STJ98001 100 µl
EUR 234
Description: Mouse monoclonal to Dkk-3.

Human DKK-4 PicoKine ELISA Kit
EK0868 96 wells
EUR 455
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).

Human DKK-3 PicoKine ELISA Kit
EK1323 96 wells
EUR 425
Description: For quantitative detection of human DKK-3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Recombinant Human Dkk-3/DKK3 Protein
RP00209 10 μg
EUR 155

DKK-3 ELISA Kit (Human) (OKBB00603)
OKBB00603 96 Wells
EUR 505
Description: Description of target: Dickkopf-related protein 3 is a protein that in humans is encoded by the DKK3 gene. This gene encodes a protein that is a member of the dickkopf family. It is mapped to 11p15.3. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Members of the Dkk-related family display unique patterns of mRNA expression in human and mouse tissues, and are secreted when expressed in 293T cells. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.;Species reactivity: Human;Application: ELISA;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: <= 10 pg/mL

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]
VAng-1451Lsx-100g 100 µg
EUR 848
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]
VAng-1451Lsx-1mg 1 mg
EUR 4724
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]
VAng-1453Lsx-100g 100 µg
EUR 1013
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]
VAng-1453Lsx-1mg 1 mg
EUR 4999
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]
VAng-1454Lsx-1mg 1 mg
EUR 6374
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]
VAng-1454Lsx-250g 250 µg
EUR 2470
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]
VAng-1454Lsx-25g 25 µg
EUR 765
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]
VAng-1455Lsx-500g 500 µg
EUR 4449
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]
VAng-1455Lsx-50g 50 µg
EUR 1013
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]
VAng-1452Lsx-200g 200 µg
EUR 3844
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]
VAng-1452Lsx-25g 25 µg
EUR 1013
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Human DKK-3(Dickkopf-related protein 3) ELISA Kit
EH0114 96T
EUR 567.6
  • Detection range: 62.5-4000 pg/ml
  • Uniprot ID: Q9UBP4
  • Alias: DKK-3/Dickkopf-3/Dkk3/REIC
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]
VAng-1456Lsx-1mg 1 mg
EUR 5494
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]
VAng-1456Lsx-50g 50 µg
EUR 848
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]
VAng-1457Lsx-200g 200 µg
EUR 1123
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]
VAng-1457Lsx-20g 20 µg
EUR 380
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Hemokinin 1 (human)
B5318-1 1 mg
EUR 340

Endothelin-1 (1-15), amide, human
A1111-1 1 mg
EUR 722
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma
7536-1
EUR 321

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-10ug 10ug
EUR 156
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-1mg 1mg
EUR 2283
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-500ug 500ug
EUR 1613
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)
CC49-50ug 50ug
EUR 369
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

BNP (1-32), human
A1105-1 1 mg
EUR 177
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

IGF-1, human recombinant
P1016-.1 100 µg
EUR 763
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein
P1054-1 1 mg
EUR 3947
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9
PROTQ01638-1 Regular: 10ug
EUR 317
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein
PROTP03956-1 Regular: 20ug
EUR 317
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9
PROTP11464-1 Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

Parathyroid hormone (1-34) (human)
A1129-1 1 mg
EUR 166
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.

Amyloid ?-Peptide (1-42) (human)
B6057-.1 100 ug
EUR 276

ApoA-1, human recombinant protein
P1052-.1 100 µg
EUR 313
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein
P1052-1 1 mg
EUR 1553
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein
P1068-1 1 mg
EUR 6940
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human ANG-1 Protein
PROTQ15389-1 20ug
EUR 317
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Recombinant Human Gremlin-1 Protein
PROTO60565-1 50ug
EUR 317
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

ORM1 Orosomucoid 1 Human protein
PROTP02763-1 Regular: 10ug
EUR 317
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Recombinant Human Galectin-1 Protein
PROTP09382-1 50ug
EUR 317
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein
PROTP16284-1 50ug
EUR 317
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein
PROTO75771-1 Regular: 10ug
EUR 317
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9
PROTP58417-1 Regular: 10ug
EUR 317
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit
EK2802-1 96 Well Plate
EUR 477

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit
EI2200-1 96 Well Plate
EUR 477

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit
EI2301-1 96 Well Plate
EUR 477

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit
EP1100-1 96 Well Plate
EUR 417

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein
PROTQ99259-1 Regular: 20ug
EUR 317
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein
PROTP01137-1 Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)
PROTP13500-1 Regular: 20ug
EUR 317
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

Ac-Endothelin-1 (16-21), human
A1016-1 1 mg
EUR 84
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.

Amyloid Beta-Peptide (1-40) (human)
A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)
B5442-1 1 mg
EUR 518

Human Hexokinase-1 AssayMax ELISA Kit
EH3101-1 96 Well Plate
EUR 477